PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27953.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family WRKY
Protein Properties Length: 168aa    MW: 19720.8 Da    PI: 9.7017
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27953.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.27.2e-3387145159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  PK27953.1  87 LDDGYRWRKYGQKAVKNNTFPRSYYRCTHHGCNVKKQVQRLTKDEGVVVTTYEGMHTHP 145
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.0E-3472145IPR003657WRKY domain
SuperFamilySSF1182909.55E-3079146IPR003657WRKY domain
PROSITE profilePS5081129.782147IPR003657WRKY domain
SMARTSM007742.5E-3887146IPR003657WRKY domain
PfamPF031061.3E-2688145IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MDQHHHQAFN NNNNVIISKD GFLGLGSDDQ NDHNHDHHDG NNNSNDNNNK KKLLGVVMKK  60
NNDDEKKNKK VKKPKFAFQT RSQVDILDDG YRWRKYGQKA VKNNTFPRSY YRCTHHGCNV  120
KKQVQRLTKD EGVVVTTYEG MHTHPIEKHT DNFEHILNQM HIYNPNNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-2877144774Probable WRKY transcription factor 4
2lex_A5e-2877144774Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112390.11e-66putative WRKY transcription factor 75
SwissprotQ9FYA21e-54WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLW9SYW21e-66W9SYW2_9R
STRINGPOPTR_0001s33560.12e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-54WRKY DNA-binding protein 75